Skip to product information
1 of 1

Gene Bio Systems

Recombinant Betula pendula Major pollen allergen Bet v 1-A(BETVIA)

Recombinant Betula pendula Major pollen allergen Bet v 1-A(BETVIA)

SKU:CSB-EP322213BSS

Regular price $1,271.00 USD
Regular price Sale price $1,271.00 USD
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Allergen

Uniprot ID: P15494

Gene Names: BETVIA

Organism: Betula pendula (European white birch) (Betula verrucosa)

AA Sequence: GVFNYETETTSVIPAARLFKAFILDGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPEGFPFKYVKDRVDEVDHTNFKYNYSVIEGGPIGDTLEKISNEIKIVATPDGGSILKISNKYHTKGDHEVKAEQVKASKEMGETLLRAVESYLLAHSDAYN

Expression Region: 2-160aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 33.4 kDa

Alternative Name(s): Allergen Bet v I-A Allergen: Bet v 1-A

Relevance: May be a general steroid carrier protein.

Reference: "The gene coding for the major birch pollen allergen Betv1, is highly homologous to a pea disease resistance response gene."Breiteneder H., Pettenburger K., Bito A., Valenta R., Kraft D., Rumpold H., Scheiner O., Breitenbach M.EMBO J. 8:1935-1938(1989)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details