Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Beet necrotic yellow vein virus (isolate Japan/S) (BNYVV)
Uniprot NO.:Q65675
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSREITARPNKNVPIVVGVCVVAFFVLLAFMQQKHKTHSGGDYGVPTFSNGGKYRDGTRS ADFNSNNHRAYGCGGSGGSVSSRVGQQLVVLAIVSVLIVSLLQRLRSPPEHICNGACG
Protein Names:Recommended name: Movement protein TGB2 Alternative name(s): 13 kDa protein P13 Triple gene block 2 protein Short name= TGBp2
Gene Names:
Expression Region:1-118
Sequence Info:full length protein