Recombinant Bdellovibrio phage phiMH2K  Uncharacterized protein N(ORFN)

Recombinant Bdellovibrio phage phiMH2K Uncharacterized protein N(ORFN)

CSB-CF884360BFAW
Regular price
$1,082.00 USD
Sale price
$1,082.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bdellovibrio phage phiMH2K (Bacteriophage phiMH2K)

Uniprot NO.:Q9G049

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:METKPNALTGTSLSSTSGQTTQKSITLQNSENKYIPQNSSETFGLMAILNLALLLWTLLA TLRVTLQKNWPTETTKTTTITQFTTLQKNTPSAKNGLKNTTNKHSHEDM

Protein Names:Recommended name: Uncharacterized protein N

Gene Names:ORF Names:ORFN

Expression Region:1-109

Sequence Info:full length protein