Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bat coronavirus HKU9 Non-structural protein 3 (3)

Recombinant Bat coronavirus HKU9 Non-structural protein 3 (3)

SKU:CSB-CF384077BOV

Regular price $1,827.00 USD
Regular price Sale price $1,827.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bat coronavirus HKU9 (BtCoV) (BtCoV/HKU9)

Uniprot NO.:A3EXG7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNLYNLVRDALRPSYATVSPSVDEPTVDNNFVALSCYATLSVLLYYLQRVKQPYLSMLFH ILFCLSQVCMVIWLIFSANFYVSLFAQCMLVVCALGCFLERTILSIKLRSMAPFMSMADN FAIIKTTCNNYVFPVERSSDNLVVLTTSRGIYSNGVFMKGAITVSDNALVVSLFKSHSLL LDRVEHGYDYTVFIYINSVILQNIKPTVSVVNTEFTDVEL

Protein Names:Recommended name: Non-structural protein 3 Short name= ns3 Alternative name(s): Accessory protein 3

Gene Names:ORF Names:3

Expression Region:1-220

Sequence Info:full length protein

View full details