Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bat coronavirus HKU4 Non-structural protein 3d (3d)

Recombinant Bat coronavirus HKU4 Non-structural protein 3d (3d)

SKU:CSB-CF385255BOT

Regular price $1,673.00 USD
Regular price Sale price $1,673.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bat coronavirus HKU4 (BtCoV) (BtCoV/HKU4/2004)

Uniprot NO.:A3EX98

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAFSASLFRTKTVHTEDAFCPRSAIQAEQPPNIIDCIPVAGYEAALITNALFLLVLFVFN PLTCKGNWIKAILFYSLLLYNMILAIFLVVDTQHFVSALLLAYVVTFLVLWTADRIRLSC AVGSVLPFVDMRSSYIRVDNGNSSVVVPMNHTKHWFIRNFEQSCHCENCFYIHSSSYVEC TFISRLKKSILVSVCDFSLGGNVSTVFVPSSDKTVPLHIIAPSKLYV

Protein Names:Recommended name: Non-structural protein 3d Short name= ns3d Alternative name(s): Accessory protein 3d

Gene Names:ORF Names:3d

Expression Region:1-227

Sequence Info:full length protein

View full details