Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bat coronavirus 133-2005 Membrane protein(M)

Recombinant Bat coronavirus 133-2005 Membrane protein(M)

SKU:CSB-CF611309BFA

Regular price $1,868.00 USD
Regular price Sale price $1,868.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bat coronavirus 133/2005 (BtCoV) (BtCoV/133/2005)

Uniprot NO.:Q0Q4E7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSSNGSLTKDEVVNIIKDWNFSWSIIFLLITIVLQYGYPSRSMMVYVFKMFILWLLWPAS MALSIFSAIYPISLASQIISGILAAICAVMWLAYFVQSIRLFMRTGSWWSFNPESNCLLN VPIGGTTVVRPLVEDSTSVTAVVNDGHLKMAGMHFGRCDYDRLPMEITVAKPSVLIALKM VKRQSYGTNSGVAIFHRYKAGNYRRPTIIQDEELALLRA

Protein Names:Recommended name: Membrane protein Short name= M protein Alternative name(s): E1 glycoprotein Matrix glycoprotein Membrane glycoprotein

Gene Names:Name:M ORF Names:5

Expression Region:1-219

Sequence Info:full length protein

View full details