Gene Bio Systems
Recombinant Bartonella henselae Type IV secretion system protein virB3(virB3)
Recombinant Bartonella henselae Type IV secretion system protein virB3(virB3)
SKU:CSB-CF882771BSG
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bartonella henselae (strain ATCC 49882 / Houston 1) (Rochalimaea henselae)
Uniprot NO.:Q9S3N1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNEDPLFLACTRPAMFAGVTMEAMAFNVMATSILFILTSGFTMIGLGIGLHFVLREITKH DHNQFRVLFAWLNTRGKQKNLNRWGGGSTSPLRLIRTYEELNR
Protein Names:Recommended name: Type IV secretion system protein virB3
Gene Names:Name:virB3 Ordered Locus Names:BH13270
Expression Region:1-103
Sequence Info:full length protein
