Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bartonella henselae Large-conductance mechanosensitive channel(mscL)

Recombinant Bartonella henselae Large-conductance mechanosensitive channel(mscL)

SKU:CSB-CF763850BSG

Regular price $1,725.00 USD
Regular price Sale price $1,725.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bartonella henselae (strain ATCC 49882 / Houston 1) (Rochalimaea henselae)

Uniprot NO.:Q6G4F8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLKEFKEFALKGNMIDLAIGVIIGGAFGGLVNSIVNDIFMPIIGLITGGIDFSNMFIQLA GEKQATLSAAKAAGATISYGNFITLLINFLIIAWVLFLFVKSMNKIRRKQEEEETSKKMS LEQQLLSEIRDLLAKKK

Protein Names:Recommended name: Large-conductance mechanosensitive channel

Gene Names:Name:mscL Ordered Locus Names:BH03860

Expression Region:1-137

Sequence Info:full length protein

View full details