Gene Bio Systems
Recombinant Banna virus Non-structural protein 4(S11)
Recombinant Banna virus Non-structural protein 4(S11)
SKU:CSB-CF897062BFAY
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Banna virus (strain Indonesia/JKT-6423/1980) (BAV)
Uniprot NO.:Q9YWQ3
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MTIQVQNLNCCPGRFVCVHKMTLLIILIISAAVTVIDQLYQKLPYDEQTKYIVSTITDGI NATIISVMAILGLNNLNRVRYSKLDENGVYSQEMVTMNVQSDAANNKKQLKKKENEDVDE EKGLYPNLKLTEPTAPMIHNYMYDHKTQQAYLLTEHQIEQIKQNSVDPNNTPKIEVRSQF
Protein Names:Recommended name: Non-structural protein 4 Short name= NS4 Alternative name(s): VP11
Gene Names:Name:S11
Expression Region:1-180
Sequence Info:full length protein
