Skip to product information
1 of 1

Gene Bio Systems

Recombinant Baiomys taylori NADH-ubiquinone oxidoreductase chain 3(MT-ND3)

Recombinant Baiomys taylori NADH-ubiquinone oxidoreductase chain 3(MT-ND3)

SKU:CSB-CF015078BRZ-GB

Regular price $1,546.00 USD
Regular price Sale price $1,546.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Baiomys taylori (Northern pygmy mouse)

Uniprot NO.:O21584

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNMIMVISVNIILSSTLILVAFWLPQLNIYTEKANPYECGFDPMSSARLPFSMKFFLVAI TFLLFDLEIALLLPIPWAIQMPDMKTMMLTAFILVSILALGLAYEWTQKGLEWTE

Protein Names:Recommended name: NADH-ubiquinone oxidoreductase chain 3 EC= 1.6.5.3 Alternative name(s): NADH dehydrogenase subunit 3

Gene Names:Name:MT-ND3 Synonyms:MTND3, NADH3, ND3

Expression Region:1-115

Sequence Info:full length protein

View full details