Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154)
Uniprot NO.:A6L171
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MYFTLLVVVILTAIALVAVALGIARAISPRSYNSQKGEAYECGIPTRGRSWMQFKVGYYL FAILFLMFDVETVFLFPWAVVVQDLGVYGLFSILFFLVILVLGLAYAWKKGALEWK
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit A EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit A NDH-1 subunit A NUO1
Gene Names:Name:nuoA Ordered Locus Names:BVU_1759
Expression Region:1-116
Sequence Info:full length protein