Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus weihenstephanensis UPF0344 protein BcerKBAB4_1054 (BcerKBAB4_1054)

Recombinant Bacillus weihenstephanensis UPF0344 protein BcerKBAB4_1054 (BcerKBAB4_1054)

SKU:CSB-CF435015BON

Regular price $1,708.00 USD
Regular price Sale price $1,708.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus weihenstephanensis (strain KBAB4)

Uniprot NO.:A9VJ15

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVHMHITAWALGLILFFVAYSLYSAGRKGKGVHMGLRLMYIIIIVTGFMLYMSIVKTATG SMHMWYGMKMLAGILVIAGMEMVLVKMSKNKPTGAVWGLFIVALVAVLYLGLKLPLGWYV FK

Protein Names:Recommended name: UPF0344 protein BcerKBAB4_1054

Gene Names:Ordered Locus Names:BcerKBAB4_1054

Expression Region:1-122

Sequence Info:full length protein

View full details