Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus weihenstephanensis UPF0295 protein BcerKBAB4_0454 (BcerKBAB4_0454)

Recombinant Bacillus weihenstephanensis UPF0295 protein BcerKBAB4_0454 (BcerKBAB4_0454)

SKU:CSB-CF430666BON

Regular price $1,551.00 USD
Regular price Sale price $1,551.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus weihenstephanensis (strain KBAB4)

Uniprot NO.:A9VST4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTIQIICPSCDKPTKMLGRVDACMHCNQPLTLDRNLEGKEFDEKYNKKSYKS

Protein Names:Recommended name: UPF0295 protein BcerKBAB4_0454

Gene Names:Ordered Locus Names:BcerKBAB4_0454

Expression Region:1-118

Sequence Info:full length protein

View full details