Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Uncharacterized protein yrvD(yrvD)

Recombinant Bacillus subtilis Uncharacterized protein yrvD(yrvD)

SKU:CSB-CF518338BRJ

Regular price $1,697.00 USD
Regular price Sale price $1,697.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:O32045

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNKQWTIIFALIFTLIVAIFAVINVRSVEVDYLFGRSEWPLILVILGSVLMGALIVFSVG IFQVMKLKREIKTLRKENRTAIHKQEDTHLADQTDTQDASAMIEKKD

Protein Names:Recommended name: Uncharacterized protein yrvD

Gene Names:Name:yrvD Ordered Locus Names:BSU27630

Expression Region:1-107

Sequence Info:full length protein

View full details