Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Uncharacterized membrane protein ysxD(ysxD)

Recombinant Bacillus subtilis Uncharacterized membrane protein ysxD(ysxD)

SKU:CSB-CF331216BRJ

Regular price $1,822.00 USD
Regular price Sale price $1,822.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P40736

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQKSILFPCLLLAASVYAWLESGQAELFSGQDQWPVLLMLLGAAFVYQGKKEAVTPHFF IGLLLFGIGLHFFAKPKWVWWPDDFEMLLFMIGFSLLVSTVQKKEYVYEAVSMICFSLFL YFFKQIMAWLESAHIPTALLKEYWPFVFIGISLLLLLIKRKKSIR

Protein Names:Recommended name: Uncharacterized membrane protein ysxD Alternative name(s): ORFY

Gene Names:Name:ysxD Ordered Locus Names:BSU28180

Expression Region:1-165

Sequence Info:full length protein

View full details