Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Stage III sporulation protein AG(spoIIIAG)

Recombinant Bacillus subtilis Stage III sporulation protein AG(spoIIIAG)

SKU:CSB-CF342638BRJ

Regular price $1,881.00 USD
Regular price Sale price $1,881.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P49784

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNKNGLWNVLKKQFLPGQTKDGEKPKLTKYHYFLFVFVLGVSFMLVSQLFSSPEKTENAK TITAVSSQHSADSKEKTAEVFKASKSDKPKDSIDDYEKEYENQLKEILETIIGVDDVSVV VNVDATSLKVYEKNKSNKNTTTEETDKEGGKRSVTDQSSEEEIVMIKNGDKETPVVVQTK KPDIRGVLVVAQGVDNVQIKQTIIEAVTRVLDVPSHRVAVAPKKIKEDS

Protein Names:Recommended name: Stage III sporulation protein AG

Gene Names:Name:spoIIIAG Ordered Locus Names:BSU24370

Expression Region:1-229

Sequence Info:full length protein

View full details