Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Quinol oxidase subunit 2(qoxA)

Recombinant Bacillus subtilis Quinol oxidase subunit 2(qoxA)

SKU:CSB-CF330405BRJ

Regular price $1,919.00 USD
Regular price Sale price $1,919.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P34957

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CSNASVLDPKGPVAEQQSDLILLSIGFMLFIVGVVFVLFTIILVKYRDRKGKDNGSYNPE IHGNTFLEVVWTVIPILIVIALSVPTVQTIYSLEKAPEATKDKEPLVVYATSVDWKWVFS YPEQDIETVNYLNIPVDRPILFKISSADSMASLWIPQLGGQKYAMAGMLMDQYLQADKVG TYEGRNANFTGEHFADQEFDVNAVTEKDFNSWVKKTQNEAPKLTKEKYDELMLPENVDEL TFSSTHLKYVDHGQDAEYAMEARKRLGYQAVSPHSKTDPFENVKKNEFKKSDDTEE

Protein Names:Recommended name: Quinol oxidase subunit 2 EC= 1.10.3.- Alternative name(s): Oxidase aa(3)-600 subunit 2 Quinol oxidase aa3-600, subunit QoxA Quinol oxidase polypeptide II

Gene Names:Name:qoxA Ordered Locus Names:BSU38170 ORF Names:ipa-37d

Expression Region:26-321

Sequence Info:full length protein

View full details