Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Putative amino acid efflux protein ycgF(ycgF)

Recombinant Bacillus subtilis Putative amino acid efflux protein ycgF(ycgF)

SKU:CSB-CF309038BRJ

Regular price $1,891.00 USD
Regular price Sale price $1,891.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P94381

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNIFLSYIVLGLSLSAPVGPVNAAQIDKGIKNGFWHAWIFGLGAMTADGLYMLFIYFGLS QFLTAPFVKTFLWLFGFFVLTYTGIETLKNVREPMDVRSSRGKPSYRKTFASGFLISLSN PLSILFWLGIYGSILAKTAEAYNMNQLLIYSSGIMIGILIWDFCMAITASTFRNLLHEKL LRGLTGIAGVSLLVFGFYFGYQGIKQLLG

Protein Names:Recommended name: Putative amino acid efflux protein ycgF

Gene Names:Name:ycgF Ordered Locus Names:BSU03090

Expression Region:1-209

Sequence Info:full length protein

View full details