Gene Bio Systems
Recombinant Bacillus subtilis Protein mistic(mstX)
Recombinant Bacillus subtilis Protein mistic(mstX)
SKU:CSB-CF701727BRJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:Q5BU39
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFCTFFEKHHRKWDILLEKSTGVMEAMKVTSEEKEQLSTAIDRMNEGLDAFIQLYNESEI DEPLIQLDDDTAELMKQARDMYGQEKLNEKLNTIIKQILSISVSEEGEKE
Protein Names:Recommended name: Protein mistic Alternative name(s): Membrane-integrating protein mstX
Gene Names:Name:mstX Ordered Locus Names:BSU31321 ORF Names:BSU31320
Expression Region:1-110
Sequence Info:full length protein
