Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus subtilis Multidrug resistance protein ykkD(ykkD)

Recombinant Bacillus subtilis Multidrug resistance protein ykkD(ykkD)

SKU:CSB-CF343036BRJ

Regular price $1,754.00 USD
Regular price Sale price $1,754.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus subtilis (strain 168)

Uniprot NO.:P49857

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLHWISLLCAGCLEMAGVALMNQYAKEKSVKWVLLIIVGFAASFSLLSYAMETTPMGTAY AVWTGIGTAGGALIGILFYKEQKDAKRIFFIALILCSAVGLKILS

Protein Names:Recommended name: Multidrug resistance protein ykkD

Gene Names:Name:ykkD Ordered Locus Names:BSU13100

Expression Region:1-105

Sequence Info:full length protein

View full details