Gene Bio Systems
Recombinant Bacillus subtilis Disulfide bond formation protein C(bdbC)
Recombinant Bacillus subtilis Disulfide bond formation protein C(bdbC)
SKU:CSB-CF516384BRJ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus subtilis (strain 168)
Uniprot NO.:O32217
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKNRIVFLYASWVVALIAMLGSLYFSEIRKFIPCELCWYQRILMYPLVLILGIATFQGDT RVKKYVLPMAIIGAFISIMHYLEQKVPGFSGIKPCVSGVPCSGQYINWFGFITIPFLALI AFILIIIFMCLLKGEKSE
Protein Names:Recommended name: Disulfide bond formation protein C Alternative name(s): Disulfide oxidoreductase C Thiol-disulfide oxidoreductase C
Gene Names:Name:bdbC Synonyms:yvgU Ordered Locus Names:BSU33470
Expression Region:1-138
Sequence Info:full length protein
