Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus pseudofirmus Uncharacterized protein BpOF4_21044(BpOF4_21044)

Recombinant Bacillus pseudofirmus Uncharacterized protein BpOF4_21044(BpOF4_21044)

SKU:CSB-CF669323BRB

Regular price $1,689.00 USD
Regular price Sale price $1,689.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus pseudofirmus (strain OF4)

Uniprot NO.:Q45130

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MNEIFKELEGDCMGENVQLKDVIFNDSKYSKTKKVLAIMFITFVFLLQVNGTDKMIGFIF VFTGTVIGVTYSVCKLLFYNTKRYIKDIVFLIIFVCLFVWGIITFFNL

Protein Names:Recommended name: Uncharacterized protein BpOF4_21044 Alternative name(s): ORFB

Gene Names:Ordered Locus Names:BpOF4_21044

Expression Region:1-108

Sequence Info:full length protein

View full details