Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus pseudofirmus Na(+)-H(+) antiporter subunit F(mrpF)

Recombinant Bacillus pseudofirmus Na(+)-H(+) antiporter subunit F(mrpF)

SKU:CSB-CF886479BRB

Regular price $1,668.00 USD
Regular price Sale price $1,668.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus pseudofirmus (strain OF4)

Uniprot NO.:Q9RGZ0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFQSILMIVLVVMSISLFVCFIRTLIGPTMSDRIVALDTFGINLIGFIGVIMMLQETLAY SEVVLVISILAFIGSIALSKFIERGVVFDRG

Protein Names:Recommended name: Na(+)/H(+) antiporter subunit F Alternative name(s): Mrp complex subunit F Multiple resistance and pH homeostasis protein F

Gene Names:Name:mrpF Ordered Locus Names:BpOF4_13185

Expression Region:1-91

Sequence Info:full length protein

View full details