Gene Bio Systems
Recombinant Bacillus phage SPbeta Protein bhlB(bhlB)
Recombinant Bacillus phage SPbeta Protein bhlB(bhlB)
SKU:CSB-CF524616BQZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus phage SPbeta (Bacillus phage SPBc2) (Bacteriophage SP-beta)
Uniprot NO.:O64038
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MFENIDKGTIVRTLLLAIALLNQIMVMLGKAAFIINEEDINHLYDCLYTIFTIVFTTSTT TAAWFKNNYITAKGKKQKQVLKKENLFK
Protein Names:Recommended name: Protein bhlB
Gene Names:Name:bhlB Ordered Locus Names:SPBc2p025
Expression Region:1-88
Sequence Info:full length protein
