Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Bacillus licheniformis (strain DSM 13 / ATCC 14580)
Uniprot NO.:Q65DJ4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MKTFIKGLGQVALLFLFARFMNLIVEVLHINIPGSILGIIVIFALLHFKIIKLEWIEIGA LWLLAELLLFFVPSAVGIMNYGDILAEFGTSIILVVLISTFVVMVSTGMLTQLIAKRKER KKTCSSDA
Protein Names:Recommended name: Holin-like protein CidA
Gene Names:Name:cidA Ordered Locus Names:BLi04057, BL03941
Expression Region:1-128
Sequence Info:full length protein