Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus cereus UPF0316 protein BCG9842_B1857 (BCG9842_B1857)

Recombinant Bacillus cereus UPF0316 protein BCG9842_B1857 (BCG9842_B1857)

SKU:CSB-CF470001BQP

Regular price $1,782.00 USD
Regular price Sale price $1,782.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain G9842)

Uniprot NO.:B7IPN4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLQALLIFVLQIIYVPILTIRTILLVKNQTRSAAGVGLLEGAIYIVSLGIVFQDLSNWMN IVAYVIGFSTGLLLGGYIENKLAIGYITYQVSLLDRCNELVDELRHSGFGVTVFEGEGIN SIRYRLDIVAKRSREKELLEIINKIAPKAFMSSYEIRSFKGGYLTKAMKKRALMKKKDEH AS

Protein Names:Recommended name: UPF0316 protein BCG9842_B1857

Gene Names:Ordered Locus Names:BCG9842_B1857

Expression Region:1-182

Sequence Info:full length protein

View full details