Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus cereus UPF0295 protein BCE33L0445(BCE33L0445)

Recombinant Bacillus cereus UPF0295 protein BCE33L0445(BCE33L0445)

SKU:CSB-CF726959BAAD

Regular price $1,741.00 USD
Regular price Sale price $1,741.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain ZK / E33L)

Uniprot NO.:Q63GA7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSIKYSNKINKIRTFALSLVFIGLFIAYLGVFFRENIIIMTTFMMVGFLAVIASTVVYFW IGMLSTKTVQIICPSCDKPTKMLGRVDACMHCNQPLTMDRNLEGKEFDEKYNKKSYKA

Protein Names:Recommended name: UPF0295 protein BCE33L0445

Gene Names:Ordered Locus Names:BCE33L0445

Expression Region:1-118

Sequence Info:full length protein

View full details