Recombinant Bacillus cereus subsp. cytotoxis  Holin-like protein CidA(cidA)

Recombinant Bacillus cereus subsp. cytotoxis Holin-like protein CidA(cidA)

CSB-CF416128BOK
Regular price
$1,100.00 USD
Sale price
$1,100.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus cereus subsp. cytotoxis (strain NVH 391-98)

Uniprot NO.:A7GR09

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKWWKLSGQILLLFCFAWTGEWIAKQVHLPIPGSIIGIFLLLISLKFNLVKKEWIQDGAD FLLKELILFFIPSAVAVIRYKDTLSQYGIDLIFIIMISTLCVTLVTGILTELLLKRKGSV Q

Protein Names:Recommended name: Holin-like protein CidA

Gene Names:Name:cidA Ordered Locus Names:Bcer98_2321

Expression Region:1-121

Sequence Info:full length protein