Skip to product information
1 of 1

Gene Bio Systems

Recombinant Bacillus cereus Probable disulfide formation protein C 1(bdbC1)

Recombinant Bacillus cereus Probable disulfide formation protein C 1(bdbC1)

SKU:CSB-CF352837BQN

Regular price $1,728.00 USD
Regular price Sale price $1,728.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Bacillus cereus (strain ATCC 10987)

Uniprot NO.:P61776

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MGREKKQEYALFTAWGASFIATLGSLYFSEIMKFEPCVLCWYQRIFMYPFVLWLGIAVVK KDYRIANYSLPIASIGACISLYHYAIQKIAAFSAAGAACGRVPCTGEYINWFGFVTIPFL ALIGFITIAVCSFIVIKNK

Protein Names:Recommended name: Probable disulfide formation protein C 1 Alternative name(s): Disulfide oxidoreductase C 1 Thiol-disulfide oxidoreductase C 1

Gene Names:Name:bdbC1 Ordered Locus Names:BCE_0823

Expression Region:1-139

Sequence Info:full length protein

View full details