Gene Bio Systems
Recombinant Bacillus cereus Membrane protein insertase YidC 2(yidC2)
Recombinant Bacillus cereus Membrane protein insertase YidC 2(yidC2)
SKU:CSB-CF772206BAM
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Bacillus cereus (strain ATCC 14579 / DSM 31)
Uniprot NO.:Q814F4
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:CSETGQPITSKSTGIWNEYFVYPLSQLITYFADLFNSNYGLAIVITTLIIRFALLPLMIK QTKSTKAMQALQPEMVKLKEKYSSKDQATQQKLQQEMMQLYQKNGVNPLAGCLPIFVQMP ILFAFYHAIMRTAEIKQHSFLWFDLGHADPFYILPVVAAITTFIQQKLAMAGTAGQNPQM AMMLWLMPIMILIFAINFPAALSLYWVVGNIFGIAQMYFIKGPEIKASKAGKAGGSSK
Protein Names:Recommended name: Membrane protein insertase YidC 2 Alternative name(s): Foldase YidC 2 Membrane integrase YidC 2 Membrane protein YidC 2
Gene Names:Name:yidC2 Ordered Locus Names:BC_5488
Expression Region:21-258
Sequence Info:full length protein
