
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Avian infectious bronchitis virus (strain H120) (IBV)
Uniprot NO.:P69604
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSNETNCTLDFEQSVELFKEYNLFITAFLLFLTIILQYGYATRSKFIYILKMIVLWCFWP LNIAVGVISCIYPPNTGGLVAAIILTVFACLSFVGYWIQSIRLFKRCRSWWSFNPESNAV GSILLTNGQQCNFAIESVPMVLSPIIKNGVLYCEGQWLAKCEPDHLPKDIFVCTPDRRNI YRMVQKYIGDQSGNKKRFATFVYAKQSVDTGELESVATGGSSLYT
Protein Names:Recommended name: Membrane protein Short name= M protein Alternative name(s): E1 glycoprotein Matrix glycoprotein Membrane glycoprotein
Gene Names:Name:M
Expression Region:1-225
Sequence Info:full length protein
You may also like
-
Recombinant Avian infectious bronchitis virus Membrane protein(M)
- Regular price
- $1,343.00 USD
- Sale price
- $1,343.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Avian infectious bronchitis virus Membrane protein(M)
- Regular price
- $1,343.00 USD
- Sale price
- $1,343.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Avian infectious bronchitis virus Membrane protein(M)
- Regular price
- $1,343.00 USD
- Sale price
- $1,343.00 USD
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Avian infectious bronchitis virus Membrane protein(M)
- Regular price
- $1,343.00 USD
- Sale price
- $1,343.00 USD
- Regular price
-
- Unit price
- per
Sold out