Recombinant Attachment invasion locus protein(ail)

Recombinant Attachment invasion locus protein(ail)

CSB-EP322286YAQ
Regular price
$803.00 USD
Sale price
$803.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: others

Target / Protein: ail

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Yersinia enterocolitica

Delivery time: 3-7 business days

Uniprot ID: P16454

AA Sequence: ASESSISIGYAQSHVKENGYTLDNDPKGFNLKYRYELDDNWGVIGSFAYTHQGYDFFYGSNKFGHGDVDYYSVTMGPSFRINEYVSLYGLLGAAHGKVKASVFDESISASKTSMAYGAGVQFNPLPNFVIDASYEYSKLDSIKVGTWMLGAGYRF

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 24-178aa

Protein length: Full Length of Mature Protein

MW: 33.2 kDa

Alternative Name(s):

Relevance: Promotes the invasion of pathogenic bacteria into eukaryotic cells by an unknown mechanism.

Reference: "Nucleotide sequence of the Yersinia enterocolitica ail gene and characterization of the Ail protein product." Miller V.L., Bliska J.B., Falkow S. J. Bacteriol. 172:1062-1069(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share