Skip to product information
1 of 1

Gene Bio Systems

Recombinant ATP synthase lipid-binding protein, mitochondrial(Y82E9BR.3)

Recombinant ATP synthase lipid-binding protein, mitochondrial(Y82E9BR.3)

SKU:CSB-CF859386CXY

Regular price $1,669.00 USD
Regular price Sale price $1,669.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q9BKS0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MENAVAARMISTTVARKDIDSAAKYIGAGAATVGVAGSGAGIGNVFGALVIGYARNPSLK QQLFSYAILGFALSEAMGLFCLTMGFMILFAL

Protein Names:Recommended name: ATP synthase lipid-binding protein, mitochondrial Alternative name(s): ATP synthase c subunit ATPase protein 9 ATPase subunit c

Gene Names:ORF Names:Y82E9BR.3

Expression Region:25-116

Sequence Info:full length protein

View full details