Gene Bio Systems
Recombinant Atlantic salmon Vertebrate ancient opsin,partial
Recombinant Atlantic salmon Vertebrate ancient opsin,partial
SKU:CSB-EP517517SWI
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: O13018
Gene Names: N/A
Organism: Salmo salar (Atlantic salmon)
AA Sequence: MDTLRIAVNGVSYNEASEIYKPHADPFTGPITNLAPWNFAVLATLMFVITSLSLFENFTVMLATYKFKQLRQPLN
Expression Region: 1-75aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-B2M-tagged
MW: 22.5 kDa
Alternative Name(s):
Relevance:
Reference: "A novel and ancient vertebrate opsin." Soni B.G., Foster R.G. FEBS Lett. 406:279-283(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.