Recombinant Aspergillus niger Aspergillopepsin-2，partial

SKU: CSB-EP338616DOZ

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Microbiology

Uniprot ID: P24665

Gene Names: N/A

Organism: Aspergillus niger

AA Sequence: EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY

Expression Region: 60-98aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 19.9 kDa

Alternative Name(s): Acid protease A Aspergillopepsin II Proctase A

Relevance:

Reference: "The gene and deduced protein sequences of the zymogen of Aspergillus niger acid proteinase A."Inoue H., Kimura T., Makabe O., Takahashi K.J. Biol. Chem. 266:19484-19489(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.