Gene Bio Systems
Recombinant Aspergillus niger Aspergillopepsin-2,partial
Recombinant Aspergillus niger Aspergillopepsin-2,partial
SKU:CSB-EP338616DOZ
Couldn't load pickup availability
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Microbiology
Uniprot ID: P24665
Gene Names: N/A
Organism: Aspergillus niger
AA Sequence: EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY
Expression Region: 60-98aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-SUMO-tagged
MW: 19.9 kDa
Alternative Name(s): Acid protease A Aspergillopepsin II Proctase A
Relevance:
Reference: "The gene and deduced protein sequences of the zymogen of Aspergillus niger acid proteinase A."Inoue H., Kimura T., Makabe O., Takahashi K.J. Biol. Chem. 266:19484-19489(1991)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
