Skip to product information
1 of 1

Gene Bio Systems

Recombinant Aspergillus niger Aspergillopepsin-2,partial

Recombinant Aspergillus niger Aspergillopepsin-2,partial

SKU:CSB-EP338616DOZ

Regular price $1,128.00 USD
Regular price Sale price $1,128.00 USD
Sale Sold out
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Microbiology

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Aspergillus niger

Delivery time: 3-7 business days

Uniprot ID: P24665

AA Sequence: EEYSSNWAGAVLIGDGYTKVTGEFTVPSVSAGSSGSSGY

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 60-98aa

Protein length: Partial

MW: 19.9 kDa

Alternative Name(s): Acid protease A Aspergillopepsin II Proctase A

Relevance:

Reference: "The gene and deduced protein sequences of the zymogen of Aspergillus niger acid proteinase A."Inoue H., Kimura T., Makabe O., Takahashi K.J. Biol. Chem. 266:19484-19489(1991)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details