Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1)
Uniprot NO.:A1CJW1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAGRHSQEKSYAEAAAAPAPEKPDSSDVTPAVPADVIYKLLGFTAAMIVGPIGMYFVTVD FGASSTVAGVTAAVTANVILFTYIYVAWLEDKEDREVAAKRKEKKAQ
Protein Names:Recommended name: Vacuolar ATPase assembly integral membrane protein VMA21
Gene Names:Name:vma21 ORF Names:ACLA_036390
Expression Region:1-107
Sequence Info:full length protein