![Recombinant Ashbya gossypii Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial(SDH4)](http://cdn.shopify.com/s/files/1/0558/8588/9636/products/no_image_default_image-jpeg_31e9d566-dd1a-48d2-a8c3-f1ece404a58a_{width}x.jpg?v=1659199762)
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Uniprot NO.:Q750S6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQGIKMASPVIRAACKRSLHQSAVRAITIPFLPTLPQNPGGVKGDVNEANPVPPANKMHG S
Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Short name= CybS Alternative name(s): Succinate-ubiquinone reductase membrane anchor subunit
Gene Names:Name:SDH4 Ordered Locus Names:AGL137W
Expression Region:1-61
Sequence Info:full length protein