Gene Bio Systems
Recombinant Ashbya gossypii Peroxisome assembly protein 22(PEX22)
Recombinant Ashbya gossypii Peroxisome assembly protein 22(PEX22)
SKU:CSB-CF765636DOT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)
Uniprot NO.:Q758W8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVSKASRDQLRKYGAVSLASLLVAASIVAYRWWNAAPSIEVEKKLRRSVSRCVVVTQGIQ NEDMIHDLLFEDTVMLLAPGCTAEGRLKSASRENAYKVISCTTWQSVWACVRHFRKHTLL VRTSEVPSGVPADIGGYVSDISDI
Protein Names:Recommended name: Peroxisome assembly protein 22 Alternative name(s): Peroxin-22
Gene Names:Name:PEX22 Ordered Locus Names:ADR410C
Expression Region:1-144
Sequence Info:full length protein
