Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ashbya gossypii Altered inheritance of mitochondria protein 39, mitochondrial(AIM39)

Recombinant Ashbya gossypii Altered inheritance of mitochondria protein 39, mitochondrial(AIM39)

SKU:CSB-CF762182DOT

Regular price $1,862.00 USD
Regular price Sale price $1,862.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Uniprot NO.:Q751C1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:QRARKRRGILLALVVAVFGTVFGYSIGYRVFYKHSESFLPLWPAKRSRPLSEKDAANLRV AEVKRMAEFRVFERLSMHKMIKEQFGVPLHTQDGKKPETNVFVLWCEDQDPCITGLLFRP SGSHAPDHGHTWHDFLGLVQWRVTHRPVSIRNAAERVLNFIGLGTSDLFQMVDPSKVYGD FKYEFPLPKRNDNDHAMHICFLGEMPLGPDSLVVYRGKYHVGVRLDQVDLFRREDGKLIR YVLYKNS

Protein Names:Recommended name: Altered inheritance of mitochondria protein 39, mitochondrial

Gene Names:Name:AIM39 Ordered Locus Names:AGL215W

Expression Region:87-333

Sequence Info:full length protein

View full details