Recombinant Ascaris suum Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial

CSB-CF310887DOS

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Ascaris suum (Pig roundworm) (Ascaris lumbricoides)

Uniprot NO.:P92507

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GATSAAVTGAAPPQFDPIAAEKGFKPLHSHGTLFKIERYFAAAMVPLIPAAYFIHGREMD LCLALALTLHVHWGVWGVVNDYGRPFVLGDTLAAAVRVGAYIFTACLLAGLLYFNEHDVG LTRAFEMVWEL

Protein Names:Recommended name: Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial Short name= CybS Alternative name(s): Cytochrome b558 small subunit Succinate-ubiquinone reductase membrane anchor subunit

Gene Names:

Expression Region:26-156

Sequence Info:full length protein