Recombinant Archaeoglobus fulgidus  Uncharacterized protein AF_1991 (AF_1991)

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_1991 (AF_1991)

CSB-CF523053DOC
Regular price
$1,101.00 USD
Sale price
$1,101.00 USD
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Uniprot NO.:O28288

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MFEPFLLAVEGQEFLTGFHVEGPLAGLIIILIALLLLWIFKKVLKLVVVLIGAVVGYFVG EAVEPSLSLVFAAGFAIVGIWAMSGDKSKKKGKKQRSILKDADDWDDDSWDDEGDWDE

Protein Names:Recommended name: Uncharacterized protein AF_1991

Gene Names:Ordered Locus Names:AF_1991

Expression Region:1-118

Sequence Info:full length protein