Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Ycf20-like protein (At1g65420)

Recombinant Arabidopsis thaliana Ycf20-like protein (At1g65420)

SKU:CSB-CF530511DOA

Regular price $1,800.00 USD
Regular price Sale price $1,800.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O80813

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MACQIQASRVFPVLEIEKGLSFMINVFHRRIKASSITLTSFPYPMKSFQIRRPNRKIAFA LDTGSSIPGDSGEGQEMNGDRTGLGSTRLGRIAIAGGKQLLGKINSARKNFPMKIFLLLL GFYTANALATILGQTGDWDVLVAGIVVAAIEGIGMLMYKKPSSSMFSGKLQSFVVFMNFW KAGVCLGLFVDAFKLGS

Protein Names:Recommended name: Ycf20-like protein

Gene Names:Ordered Locus Names:At1g65420 ORF Names:T8F5.20

Expression Region:1-197

Sequence Info:full length protein

View full details