Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Uncharacterized ribosomal S3-like protein AtMg00690, mitochondrial (AtMg00690)

Recombinant Arabidopsis thaliana Uncharacterized ribosomal S3-like protein AtMg00690, mitochondrial (AtMg00690)

SKU:CSB-CF308992DOA

Regular price $1,852.00 USD
Regular price Sale price $1,852.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:P92511

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MRSSVLRSLRGRLVINLESTRKLRLSRTNIVPGRKKGQKSIKSKNMARKGNPILVRLGKN RSSDSSWFSAEALLGCLYFFIYFVAPTLGPVLFLLRLIHFVWGLRLGLGNENFHFGVGPD GGATGLDLNQPPQEQQPTLGVNRAALDLNELPPVHLLYAEVEGPQSTKAQNDVMLAHLNQ VQNLTRDLQTEPNIWRRQALIDILDWEVRSLQRHFRIFRQRDRLREVQRSWLREQLNRYR

Protein Names:Recommended name: Uncharacterized ribosomal S3-like protein AtMg00690, mitochondrial Alternative name(s): ORF240a

Gene Names:Ordered Locus Names:AtMg00690

Expression Region:1-240

Sequence Info:full length protein

View full details