Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Reticulon-like protein B16(RTNLB16)

Recombinant Arabidopsis thaliana Reticulon-like protein B16(RTNLB16)

SKU:CSB-CF818125DOA

Regular price $1,838.00 USD
Regular price Sale price $1,838.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8GYH6

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDSLSDIDGDFDGRNEGGSSSDYRLLGRQITVHQFMGGGKAADLLLWRRRHLSLGVIIIS TVAWLIFEFSGLPFLSVSSDVLLIVIMISFVHARVSAFRNRQLHSLPELVLSEEMVNSAA ASFRIKLNHLLVMAHDVTVGNDFRLFFKVVICLWLLSAIGSYISLCTLLYIGTILSVTIP ALYSKYQSKVDKCCGTIHRRLSHHYKIVDENVISRLSWSLSKDKDS

Protein Names:Recommended name: Reticulon-like protein B16 Short name= AtRTNLB16

Gene Names:Name:RTNLB16 Ordered Locus Names:At3g10915 ORF Names:F9F8.30

Expression Region:1-226

Sequence Info:full length protein

View full details