Gene Bio Systems
Recombinant Arabidopsis thaliana Protein transport protein Sec61 subunit beta (At2g45070)
Recombinant Arabidopsis thaliana Protein transport protein Sec61 subunit beta (At2g45070)
SKU:CSB-CF020958DOA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:P38389
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MVGSGAPQRGSAAATASMRRRKPTSGAGGGGASGGAAGSMLQFYTDDAPGLKISPNVVLIMSIGFIAFVAVLHVMGKLYFVK
Protein Names:Recommended name: Protein transport protein Sec61 subunit beta
Gene Names:Ordered Locus Names:At2g45070 ORF Names:T14P1.12
Expression Region:1-82
Sequence Info:full length protein
