Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein TIC 20-II, chloroplastic(TIC20-II)

Recombinant Arabidopsis thaliana Protein TIC 20-II, chloroplastic(TIC20-II)

SKU:CSB-CF526861DOA

Regular price $1,753.00 USD
Regular price Sale price $1,753.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O82251

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ASYTPTPATERVISIASYALPFFNSLQYGRFLFAQYPRLGLLFEPIFPILNLYRSVPYAS FVAFFGLYLGVVRNTSFSRYVRFNAMQAVTLDVLLAVPVLLTRILDPGQGGGFGMKAMMW GHTGVFVFSFMCFVYGVVSSLLGKTPYIPFVADAAGRQL

Protein Names:Recommended name: Protein TIC 20-II, chloroplastic Alternative name(s): Tanslocon at the inner envelope membrane of chloroplasts 20-II Short name= AtTIC20-II

Gene Names:Name:TIC20-II Ordered Locus Names:At2g47840 ORF Names:F17A22.23

Expression Region:50-208

Sequence Info:full length protein

View full details