Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein RER1A(RER1A)

Recombinant Arabidopsis thaliana Protein RER1A(RER1A)

SKU:CSB-CF526169DOA

Regular price $1,793.00 USD
Regular price Sale price $1,793.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:O48670

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDESGGDSGSVATPVQQRAHEAWRIYQHYLDKTTPHANYRWIGTLVVALIYCLRVYYIQG FYIIAYGLGIYLLNLLIGFLSPLVDPEAGGVSDGPSLPTRGSDEFKPFIRRLPEFKFWYS MTKAFCIAFLMTFFSVFDVPVFWPILLCYWIVLFVLTMRRQIAHMIKYKYIPFSFGKQKY GGRSSSGSRAD

Protein Names:Recommended name: Protein RER1A Short name= AtRER1A

Gene Names:Name:RER1A Ordered Locus Names:At4g39220 ORF Names:T22F8.120

Expression Region:1-191

Sequence Info:full length protein

View full details