Skip to product information
1 of 1

Gene Bio Systems

Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 10(PCR10)

Recombinant Arabidopsis thaliana Protein PLANT CADMIUM RESISTANCE 10(PCR10)

SKU:CSB-CF851422DOA

Regular price $1,842.00 USD
Regular price Sale price $1,842.00 USD
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Arabidopsis thaliana (Mouse-ear cress)

Uniprot NO.:Q8S8T8

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKEKKGHYVPPSYIPLTQSDADTEVETTTPNLEIAVSESTKDDPRQWSSGICACFDDMQS CCVGLFCPCYIFGKNAELLGSGTFAGPCLTHCISWALVNTICCFATNGALLGLPGCFVSC YACGYRKSLRAKYNLQEAPCGDFVTHFFCHLCAICQEYREIREQSSGSYPLDMKMAITNA PLAQTMESAN

Protein Names:Recommended name: Protein PLANT CADMIUM RESISTANCE 10 Short name= AtPCR10

Gene Names:Name:PCR10 Ordered Locus Names:At2g40935 ORF Names:T20B5

Expression Region:1-190

Sequence Info:full length protein

View full details