Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Arabidopsis thaliana (Mouse-ear cress)
Uniprot NO.:Q8GSJ6
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:AELDPNTVVAISVGVASVALGIGIPVFYETQIDNAAKRENTQPCFPCNGTGAQKCRLCVG SGNVTVELGGGEKEVSNCINCDGAGSLTCTTCQGSGVQPRYLDRREFKDDD
Protein Names:Recommended name: Protein disulfide-isomerase LQY1 EC= 5.3.4.1 Alternative name(s): Protein LOW QUANTUM YIELD OF PHOTOSYSTEM II 1
Gene Names:Name:LQY1 Ordered Locus Names:At1g75690 ORF Names:F10A5.12, F10A5.4
Expression Region:44-154
Sequence Info:full length protein